PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.J565900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 292aa    MW: 32227.1 Da    PI: 8.4809
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.J565900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3703.3e-113229077374
               GRAS  77 elaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakf 168
                        +l++++++++++P++kf+h+taNqaI ea++ge+rvH++D+di qG QWpa+lqaLa+Rp+gpp+lR+Tgvg+     + +++etg+ La++
  Pavir.J565900.1.p   2 TLKIYQILYQACPYVKFAHFTANQAIFEAFHGEDRVHVVDLDILQGYQWPAFLQALAARPGGPPTLRLTGVGH----PAAAVRETGRHLASL 89 
                        57899********************************************************************....88************* PP

               GRAS 169 AeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflea 260
                        A++l+vpfef++ va+rle l++ +L+ + gEalaVn v +lhr++   v+l      +L+++++  Pk++++veqea hn++ Fl rflea
  Pavir.J565900.1.p  90 AASLRVPFEFHAAVADRLERLRPAALQRRVGEALAVNAVNRLHRVP--GVHLGP----LLSMIRDQAPKIMTLVEQEAGHNGPYFLGRFLEA 175
                        *********************************************9..666666....********************************** PP

               GRAS 261 leyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrv 351
                        l+yysa+fdsl+a++p++s  r kvE+ ll++ei+nvvacegaer++rhe+l +Wr+ +e  GF+pv+ls  a+ q + ll  ++ +dgyr+
  Pavir.J565900.1.p 176 LHYYSAIFDSLDATFPADSAPRLKVEQCLLAPEIRNVVACEGAERVARHERLDRWRRLMEGRGFEPVRLSPAAVGQSQVLLGLYGaGDGYRL 267
                        ******************************************************************************************** PP

               GRAS 352 eeesgslvlgWkdrpLvsvSaWr 374
                         e++g+l+lgW+dr+++++SaWr
  Pavir.J565900.1.p 268 TEDKGCLLLGWQDRAIIAASAWR 290
                        **********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.9821269IPR005202Transcription factor GRAS
PfamPF035141.1E-1102290IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
DTLKIYQILY QACPYVKFAH FTANQAIFEA FHGEDRVHVV DLDILQGYQW PAFLQALAAR  60
PGGPPTLRLT GVGHPAAAVR ETGRHLASLA ASLRVPFEFH AAVADRLERL RPAALQRRVG  120
EALAVNAVNR LHRVPGVHLG PLLSMIRDQA PKIMTLVEQE AGHNGPYFLG RFLEALHYYS  180
AIFDSLDATF PADSAPRLKV EQCLLAPEIR NVVACEGAER VARHERLDRW RRLMEGRGFE  240
PVRLSPAAVG QSQVLLGLYG AGDGYRLTED KGCLLLGWQD RAIIAASAWR C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-53629080375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1363770.0AC136377.4 Oryza sativa Japonica Group chromosome 11 clone OSJNBa0028G07, complete sequence.
GenBankAC1377590.0AC137759.4 Oryza sativa Japonica Group chromosome 11 clone OSJNBb0008H02, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450783.10.0hypothetical protein SORBIDRAFT_05g018070
SwissprotQ8S4W78e-97GAI1_VITVI; DELLA protein GAI1
TrEMBLC5Y2P60.0C5Y2P6_SORBI; Putative uncharacterized protein Sb05g018070
STRINGSb05g018070.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP92213141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.12e-95RGA-like 1